The list of tumor cell ANTIGENS against
which the vaccine RESAN is directed to act upon

 

 

The antitumor vaccine RESAN contains imitators of mainly three major groups of tumor antigens due to which it acts as cancer vaccine triggering immune responses against wide types of tumors. The three groups of tumor antigens against which the vaccine RESAN is directed to act upon are: 
1. 22 peptide fragments of the Homo sapiens telomerase ferment (hTRT);
2. Cytokeratin-19 (CYFRA21-1);
3. Peptide fragments of 40 most common cancer specific antigens.

1. Homo sapiens telomerase ferment (hTRT)

Homo sapiens telomerase reverse transcriptase (hTRT) is a tumor-associated antigen expressed in the vast majority of human tumors and is presently one of the most promising target candidates for a therapeutic cancer vaccine [22, 23, 24, 25]. (This enzyme is in silent/inactive in normal tissues except in some body cells-like stem cell, basal cells of epidermis, male and female reproductive cells but it is most active in more than 85% of the cancer cells) [24].

It is this very enzyme, which enables the cancer cells to under go endless cell divisions. The fragments of this enzyme in complex with HLA molecules are located on the cancer cell membranes. The vaccine RESAN, in its basic composition, include glycoproteins which are analogous to 22 peptide fragments of the telomerase enzyme (hTRT). Due to this, the vaccine possesses a broad spectrum of antitumor activities.

In the amino acidic sequence of hTRT (Table 1), the peptide fragments are shown  in orange colour which are present in the vaccine RESAN  (the  international single-letter designation of amino acids is illustrated).

Table 1. 

mpraprcravrsllrshyrevlplatfvrrlgpqgwrlvqrgdpAAFRALVAQCLvcvpwdarppp 
aapsfrqvsCLKELVARVlqrlcergaknvLAFGFALLdgarggppeafttsvrsylpntvtdalr 
gsgawglllrrVGDDVLVHllarcalFVLVAPSCAyqvcgpplyqlGAATQARPpphasgprrrlg 
cerawnhsvreagvplglpapgarrrggsasrslplpkrprrgaapepertpvgqgswahpgrtrg 
psdrgfcvvsparpaeeatslegalSGTRHSHpsvgrqhhagppstsrpprpwdtpcppvyaetkh 
flyssgdKEQLRPSFLLSSLRPSLtgarrlvetiflgsrpwmpgtprrlprlpqrywqmrPLFLEL 
LgnhaqcpygvllkthcplrAAVTPAAgvcarekpqgsvaapeeedtdprrlvqllrqhsspwqvy 
gfvraclrrlvppglwgsrhnerrflrntkkfislgkhaklslqeltwkmsvrdcawlrrspgvgc 
vpaaehrlreeilakflhwlmsvyvvellrsffyvtettfqknrlffyrksvwsklQSIGIRQhlk 
rvqlrelseaevrqhrearpalltsrlrfipkpdglrpIVNMDYVvgartfrrekraerltsrvka 
lfsvlnyerarRPGLLGASVLglddihrawrtfvlrvraqdpppelyfvkvdvtgaydtipqdrlt 
eviasiikpqntycvrryavvqkaahghvrkafkshvsTLTDLQPymrqfvahlqetsplrdavvi 
eqssslneassglfdvflrfmchhavrirgksyvqcqgipqgsilstLLCSLCYGdmenklfagir 
rdglllrlvddfllvtphlthaktflrtLVRGVPEYGCVVNLRktvvnfpvedealggtafvqmpa 
hglfpwcgllldtrtlevqsdYSSYARTSIRASLtfnrgfkagrnmrrklfgvlrlkchslfldlq 
vnslqtvctnIYKILLLQAYrfhacvlqlpfhqqvwknptfflrvisdtaslcysilkaknagmsL 
GAKGAAgplpseavqwlchqafllkltrhrvtYVPLLGSLrtaQTQLSRKLPgttltALEAAANPA 
Lpsdfktild                                                         
The administration of vaccine RESAN in an organism triggers the immune mechanism to form specific antitumoral T-lymphocytes (CTLs) against the cells with active telomerase enzyme i. e. cancer cells. The specific antitumoral T-lymphocyte  recognizes the tumor peptides (each with 8-10 amino acids) represented in a complex HLA class I molecule on the cancer cell membranes and destroy them.

2. Cytokeratin fragment 19 (CYFRA 21-1)

Most of the malignant tumors are hard in consistency. This is due to the presence
of a strong cellular structure known as the cytoskeleton, which consists of
proteins – cytokeratins. There are more than 20 known types of cytokeratins. For
example – the cytokeratin fragment 19  is located in many of the epithelial malignant cells. With the help of these strong cytokeratins, the cancer cells displace the normal cells invading new spaces for their growth into the healthy tissues. 

In a healthy person the concentration of cytokeratin-19 in blood serum may deviate from 0.1 to 3.3 ng/mL; thus the normal (average) concentration of cytokeratin-19 is considered as 2.1 ng/mL [21]. Today the cytokeratins-19 test is used as a standard tumor marker for the diagnosis of metastatic growths of cancers from epithelial cells; this tumor marker has been found elevated in different types of epithelial cancers: prostate cancers [1], hepatocellular carcinoma [2, 3, 4], pancreatic carcinoma [5, 6], breast cancer [7, 8, 9], ovarian adenocarcinoma [10, 11], basal cell carcinoma [12], thyroid tumors [13], colorectal cancer [7, 14], squamous cell carcinoma of head and neck [7, 15], neoplastic lymphadenopathies [20], lung carcinoma [7, 17, 18, 19, 20].

The vaccine RESAN is the first cancer vaccine, which contains, in its chemical composition, the imitators of the protein fragments of the cellular cytoskeleton located in the malignant tumors. With the help of Enzyme-Linked Immunosorbent Assay (ELISA) kit (Hoffman-La Rosch CYFRA 21-1), it was determined that in a single vial of the vaccine RESAN (200 mg) the concentration of the cytokeratin-19 was 20 times higher than in the blood serum of a healthy person. This allows us to use the vaccine to trigger specific antitumor immune responses against various types of human epithelial tumors. Thus, the presence of the cytokeratin-19 imitators in the vaccine composition is one more important factor, which makes it "a cancer vaccine of wide spectrum". 

 3. Peptide fragments of 40 most common cancer specific antigens

In order to intensify and widen the spectrum of the anti tumor immune responsing capacity of the vaccine even more, other additional glycoproteins are included in the composition of  vaccine RESAN whose (glycoproteins) peptide fragments are analogous to some particular fragments of 40 most common cancer antigens (Table 2).

Table 2.

 1. SQUAMOUS CELL CARCINOMA ANTIGEN 1 (SCCA-1), (PROTEIN T4-A)
 2. SQUAMOUS CELL CARCINOMA ANTIGEN 2 (SCCA-2)
 3. Ovarian carcinoma antigen CA125 (1A1-3B) (KIAA0049)
 4. MUCIN 1 (TUMOR-ASSOCIATED MUCIN), (CARCINOMA-ASSOCIATED
 MUCIN), (POLYMORPHIC EPITHELIAL  MUCIN),(PEM),(PEMT),(EPISIALIN),
 (TUMOR-ASSOCIATED EPITHELIAL MEMBRANE ANTIGEN),(EMA),(H23AG),
 (PEANUT-REACTIVE URINARY MUCIN), (PUM), (BREAST CARCINOMA-
 ASSOCIATED ANTIGEN DF3)
 5. CTCL tumor antigen se1-1
 6. CTCL tumor antigen se14-3
 7. CTCL tumor antigen se20-4
 8. CTCL tumor antigen se20-9
 9. CTCL tumor antigen se33-1
 10. CTCL tumor antigen se37-2
 11. CTCL tumor antigen se57-1
 12. CTCL tumor antigen se89-1
 13. Prostate-specific membrane antigen
 14. 5T4 oncofetal trophoblast glycoprotein
 15. Orf73 Kaposi's sarcoma-associated herpesvirus
 16. MAGE-C1 (cancer/testis antigen CT7)
 17. MAGE-B1 ANTIGEN (MAGE-XP ANTIGEN) (DAM10)
 18. MAGE-B2 ANTIGEN (DAM6)
 19. MAGE-2 ANTIGEN
 20. MAGE-4a antigen
 21. MAGE-4b antigen
 22. Colon cancer antigen NY-CO-45
 23. Lung cancer antigen NY-LU-12 variant A
 24. Cancer associated surface antigen
 25. Adenocarcinoma antigen ART1
 26. Paraneoplastic associated brain-testis-cancer antigen
 (onconeuronal antigen MA2; paraneoplastic neuronal antigen)
 27. Neuro-oncological ventral antigen 2 (NOVA2)
 28. Hepatocellular carcinoma antigen gene 520
 29. TUMOR-ASSOCIATED ANTIGEN CO-029
 30. Tumor-associated antigen MAGE-X2
 31. Synovial sarcoma, X breakpoint 2
 32. Squamous cell carcinoma antigen recognized by T cell
 33. Serologically defined colon cancer antigen 1
 34. Serologically defined breast cancer antigen NY-BR-15
 35. Serologically defined breast cancer antigen NY-BR-16
 36. Chromogranin A; parathyroid secretory protein 1
 37. DUPAN-2
 38. CA 19-9
 39. CA 72-4
 40. CA 195
These glycoproteins included in the composition of the vaccine imitate 6-50 different peptide fragments (each with 7-30 amino acids) of each cancer antigens illustrated above.

References

1. Nagle R. B. et al. Phenotypic relationships of prostatic intraepithelial neoplasia to invasive prostatic carcinoma.  / Am. J. Pathol. 1991, 138 (1), 119-128.

2. Hsia C. C. et al. Occurence of oval-type cells in hepatitis B virus-associated human hepatocarcinogenesis. / Hepatology 1992, 16 (6), 1327-1333.

3. Thorgeirssen S. S. Target cell populations in virus-associated hepatocarcinogenesis. / Princess Tagamatsu Symp. 1995, 25, 163-170.

4. Van Eyken P. et al. Immunocytochemistry of cytokeratins in primary human liver tumors. / APMIS Suppl. 1991, 23, 77-85.

5. Van Noorden C. J. et al. Ectopic mineralized cartilage formation in human undifferentiated pancreatic adenocarcinoma explants grown in nude mice. / Calcif. Tissue Int. 1995, 56 (2), 145-153.

6. Thorban S. et al. Epithelial tumour cells in bone marrow of patients with pancreatic carcinoma detected by immunocytochemical staining. / Eur. J. Cancer 1996, 32A (2), 363-365.

7. Pantel K. et al. Establishment of micrometastatic carcinoma cell lines: a novel source of tumor cell vaccines. / J. Natl. Cancer Inst. 1995, 87 (15), 1162-1168.

8. Kruger W. et al. Reverse transcriptase/polymerase chain reaction detection of cytokeratin-19 mRNA in bone marrow and blood of breast cancer patients. / J. Cancer Res. Clin. Oncol. 1996, 122 (11), 679-686.

9. Ethier S. P. et al. Differential isolation of normal luminal mammary epithelial cells and breast cancer cells from primary and metastatic sites using selective media. / Cancer Res. 1993, 53 (3), 627-635.

10. Gorai I. et al. Establishment and characterization of two human ovarian clear cell adenocarcinoma lines from metastatic lesions with different properties. / Gynecol. Oncol. 1995, 57 (1), 33-46.

11. Mobus V. et al. Morphological, immunohistochemical and biochemical characterization of 6 newly established human ovarian carcinoma cell lines. / Int. J. Cancer 1992, 52 (1), 76-84.

12. Kooy A. J. W. et al. Expression of cytokeratin 8 and low molecular weight cytokeratins in human basal cell carcinoma. / Anticancer Res. 1995, 15, 241-248.

13. Raphael S. J. et al. Brief report: detection of high-molecular-weight cytokeratins in neoplastic and non-neoplastic thyroid tumors using microwave antigen retrieval. / Modern Pathol. 1995, 8 (8), 870-872.

14. Braun S. & Pantel K. Immunodiagnosis and immunotherapy of isolated tumor cells disseminated to bone marrow of patients with colorectal cancer. / Tumori 1995, 81 (Suppl.), 78-83.

15. Doweck I. et al. CYRFA 21-1. A new potential tumor marker for squamous cell carcinoma of head and neck. / Arch. Otolaryngol. Head Surg 1995. 121, 177-181.

16. Gould V. E. et al. Increased numbers of cytokeratin-positive interstitial reticulum cells (CIRC) in reactive, inflammatory and eoplastic lymphadenopathies: hyperplasia or induced expression. / Virch. Arch. 1995, 425, 617-629.

17. Muraki M. et al. Assessment of serum CYFRA 21-1 in lung cancer. / Cancer 1996,  77, 1274-1277.

18. Niklinski J. et al. Diagnostic and prognostic value of the new tumour marker CYRFA 21-1 in patients with squamous cell lung cancer. / Eur. Respir. J. 1995, 8, 291-294.

19. Trevisani L. et al. Cytokeratin tumor marker levels in bronchial washing in the diagnosis of lung cancer. / Chest 1996, 109, 104-108.

20. Molina R. et al. Study of a new tumor marker, CYRFA 21-1, in malignant and nonmalignant diseases. / Tumor Biol. 1994, 15, 318-325.

21. Behbehani A.I., Mathew A., Farghaly M., A.Van Dalen. Reference levels of the tumor markers carcinoembryonic antigen, the carbohydrate antigens 19-9 and 72-4, and cytokeratin fragment 19 using the ŽElecsys Relecsys 1010 analyzer in a normal population in Kuwait. The importance of the determination of local reference levels. / The International Journal of Biological Markers, 2002, Vol. 17 (1), 67-70.

22. Identification of a human telomerase reverse transcriptase peptide of low affinity for HLA A2.1 that induces cytotoxic T lymphocytes and mediates lysis of tumor cells.
 Hernandez J., Garcia-Pons F., Lone Y.C., Firat H., Schmidt J.D., Langlade-Demoyen P., Zanetti M. / Proc Natl Acad Sci USA 2002 Sep17; 99(19): 12275-80. / Department of Medicine and Cancer Center, University of California at San Diego, 9500 Gilman Drive, La Jolla, CA 92093-0837, USA.

23. Tumour immunotherapy: new tools, new treatment modalities and new T-cell antigens.
Schultze J.L., Maecker B., Von Bergwelt-Baildon M.S., Anderson K.S., Vonderheide R.H. / Vox Sang 2001 Feb; 80(2):81-9. / Department of Adult Oncology, Dana-Farber Cancer Institute, 44 Binney Street, D540C, Boston, MA 02115, USA.

24. Induction of cytotoxic T cell responses and tumor immunity against unrelated tumors using telomerase reverse transcriptase RNA transfected dendritic cells.
Nair S.K., Heiser A., Boczkowski D., Majumdar A., Naoe M., Lebkowski J.S., Vieweg J., Gilboa E. / Department of Surgery, Center for Genetic and Cellular Therapies, Duke University Medical Center, Durham, NC 27710, USA.

25. Cytotoxic T cell immunity against telomerase reverse transcriptase in humans.
Minev B., Hipp J., Firat H., Schmidt J.D., Langlade-Demoyen P., Zanetti M. / Proc Natl Acad Sci USA 2000 Apr 25; 97(9): 4796-801. / Departments of Medicine and Cancer Center, University of California, San Diego, 9500 Gilman Drive, La Jolla, CA 92093-0368, USA.

                 [ Home page ][ Contact us ][ Site map ]

 

 

Site map

•The main page. Anticancer vaccine RESAN. A short instruction

•Indications and dosages

•The list of malignant tumors susceptible to RESAN immunotherapy

•The antigenic composition of RESAN

•The mechanism of development of antitumor immune answer by RESAN

•The interaction between the immune system and tumors

•The traditional standard methods are unable to solve the problems of metastases and relapses of malignant tumors

•The most rational use of RESAN in immunotherapy of cancers

•Immunotherapy of advanced cancers

•Vaccination for the prevention of different types of tumors

•FAQs - immunotherapy of tumors using RESAN

•FAQs -The FDA approval and other moments...

•The lab testing for RESAN vaccine

•Immunotherapy of benign prostatic hyperplasia, prostate adenoma and prostate cancer

•Vaccinotherapy of mastopathy and breast cancer

•Immunotherapy of endometriosis

•Immunotherapy of uterine myoma

•Revaccination to maintain further the anticancer immune activities

Anticancer Vaccine RESAN